Use Able AI chat for product recommendations

FBXW7 Monoclonal antibody, PBS Only (Detector)

FBXW7 Monoclonal Antibody for Cytometric bead array, Indirect ELISA

Cat No. 67234-1-PBS
Clone No.2A10E5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CDC4, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, F-box/WD repeat-containing protein 7, FBW7

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67234-1-PBS targets FBXW7 as part of a matched antibody pair:

MP51687-1: 67234-2-PBS capture and 67234-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28471

Product name: Recombinant human FBXW7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-227 aa of NM_001349798

Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS

Predict reactive species
Full Name F-box and WD repeat domain containing 7
Calculated Molecular Weight 66 kDa
GenBank Accession NumberNM_001349798
Gene Symbol FBXW7
Gene ID (NCBI) 55294
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969H0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FBXW7, also named as FBW7, FBX30, SEL10 and hAgo, is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins. FBXW7 is involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. FBXW7 is a general tumor suppressor in human cancer (PMID: 17909001). FBXW7 has 3 isoforms (α/β/γ) with the calculated molecular mass of 80 kDa, 70 kDa and 66 kDa, and apparent molecular mass of 100-110 kDa and 66-75 kDa (PMID: 18559665).

Loading...
||
New chat

Able

正在加载,请稍候...