FBXW9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FBXW9 Polyclonal antibody, PBS Only (20464-1-PBS)

• 

  WB analysis using 20464-1-AP (same clone as 20464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20464-1-AP (FBXW9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20464-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 20464-1-AP (same clone as 20464-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using FBXW9 antibody (20464-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 20464-1-PBS in a different storage buffer formulation.

FBXW9 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 20464-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Fbw9

---

Product Information

20464-1-PBS targets FBXW9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14300

  Product name: Recombinant human FBXW9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC004290

  Sequence: MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTWRLRALRRVRAPYPVVEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLIKTLGTKRNSTHEGWVWSLAAQDHRVCSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQLDSYLL

• Full Name: F-box and WD repeat domain containing 9
• Calculated Molecular Weight: 488 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC004290
• Gene Symbol: FBXW9
• Gene ID (NCBI): 84261
• RRID: AB_3741995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5XUX1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.