CD89 Polyclonal antibody

• 

  WB analysis using 13245-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13245-1-AP (CD89 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 13245-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13245-1-AP (CD89 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CD89 Polyclonal Antibody for WB, ELISA

Cat No. 13245-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, ELISA

Synonyms

IgA Fc receptor, FCAR

---

Tested Applications

• Positive WB detected in: pig lung tissue, HL-60 cells, pig spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13245-1-AP targets CD89 in WB, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3928

  Product name: Recombinant human FCAR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-227 aa of BC027953

  Sequence: QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

• Full Name: Fc fragment of IgA, receptor for
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 55-75 kDa
• GenBank Accession Number: BC027953
• Gene Symbol: CD89
• Gene ID (NCBI): 2204
• RRID: AB_2293907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24071
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.