FCGR2A / CD32a Polyclonal antibody

• 

  WB analysis using 15625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15625-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 15625-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of THP-1 using 15625-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using FCGR2A / CD32a antibody (15625-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FCGR2A / CD32a Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15625-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

CD32, CD32A, Fc gamma RII a, Fc gamma RIIa, FCG2

---

Tested Applications

• Positive WB detected in: K-562 cells, U-937 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 11 publications below
• IHC: See 2 publications below
• IF: See 7 publications below
• CoIP: See 1 publications below

Product Information

15625-1-AP targets FCGR2A / CD32a in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8072

  Product name: Recombinant human FCGR2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC020823

  Sequence: MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

• Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC020823
• Gene Symbol: CD32a
• Gene ID (NCBI): 2212
• RRID: AB_2246912
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IgG Fc receptors (FcγRs) play important roles in immune responses. Low affinity IgG Fc receptor Fc gamma RIIa (FCGR2A, CD32a) is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse	WB	Int J Mol Sci; Ursolic Acid Alleviates Neuroinflammation after Intracerebral Hemorrhage by Mediating Microglial Pyroptosis via the NF-κB/NLRP3/GSDMD Pathway; Authors - Pan Lei
rat	WB	Exp Neurol; Photobiomodulation therapy promotes neurogenesis by improving post-stroke local microenvironment and stimulating neuroprogenitor cells.; Authors - Luodan Yang
human	WB	Am J Pathol; FcγRIIa ligation induces platelet hypersensitivity to thrombotic stimuli.; Authors - Berlacher Mark D MD
rat	WB	J Alzheimers Dis; Treadmill Exercise Exerts Neuroprotection and Regulates Microglial Polarization and Oxidative Stress in a Streptozotocin-Induced Rat Model of Sporadic Alzheimer's Disease.; Authors - Yujiao Lu
mouse	WB	Cell Death Dis; Pentraxin 3 regulated by miR-224-5p modulates macrophage reprogramming and exacerbates osteoarthritis associated synovitis by targeting CD32.; Authors - Jianbin Yin
mouse	WB,IF	Int Immunopharmacol; Grossamide attenuates inflammation by balancing macrophage polarization through metabolic reprogramming of macrophages in mice; Authors - Wenlong Zhao