FCGR2A / CD32a Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FCGR2A / CD32a Polyclonal antibody (15625-1-AP)

• KD/KO Validated

FCGR2A / CD32a Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15625-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

CD32, CD32A, Fc gamma RII a, Fc gamma RIIa, FCG2

• 

  WB analysis using 15625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 15625-1-AP

  WB result of FCGR2A / CD32a antibody (15625-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-FCGR2A / CD32a transfected K-562 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15625-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15625-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15625-1-AP (FCGR2A / CD32a antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 15625-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using FCGR2A / CD32a antibody (15625-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells, U-937 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15625-1-AP targets FCGR2A / CD32a in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8072

  Product name: Recombinant human FCGR2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC020823

  Sequence: MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

• Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC020823
• Gene Symbol: CD32a
• Gene ID (NCBI): 2212
• RRID: AB_2246912
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IgG Fc receptors (FcγRs) play important roles in immune responses. Low affinity IgG Fc receptor Fc gamma RIIa (FCGR2A, CD32a) is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cancer Cell; Infiltrating plasma cells maintain glioblastoma stem cells through IgG-Tumor binding; Authors - Jiancheng Gao ; KD Validated
		Nat Biotechnol; Genome-wide mapping of RNA-protein associations through sequencing; Authors - Zhijie Qi
mouse		J Control Release; Accelerate wound healing by microscale gel array patch encapsulating defined SDF-1α gradient; Authors - Zhen Xu
mouse	WB	Cell Death Dis; Pentraxin 3 regulated by miR-224-5p modulates macrophage reprogramming and exacerbates osteoarthritis associated synovitis by targeting CD32.; Authors - Jianbin Yin
human	IHC	Mol Cell Proteomics; Multiomics Profiling Reveals Distinct Immunosuppression and Metabolic Dysregulation in Aggressive Subtypes of Thyroid Cancer.; Authors - Shanying Gui
rat	IF	Drug Des Devel Ther; Morin Regulates M1/M2 Microglial Polarization via NF-κB p65 to Alleviate Vincristine-Induced Neuropathic Pain; Authors - Yi Shao