FCGR3B/CD16b Monoclonal antibody, PBS Only (Capture/Detector)

• 

  Sandwich ELISA standard curve of MP50059-1

  Sandwich ELISA standard curve of MP50059-1, FCGR3B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68677-1-PBS. Detection antibody: 68677-2-PBS. Standard: Eg0308. Range: 0.39-25 ng/mL.

• 

  Sample test of MP50059-1

  Serum of sixteen individual healthy human donors was measured. The FCGR3B/CD16b concentration of detected samples was determined to be 363.71 ng/mL with a range of 99.26-857.41 ng/mL.

• 

  Cytometric bead array standard curve of MP50059-2

  Cytometric bead array standard curve of MP50059-2, FCGR3B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68677-2-PBS. Detection antibody: 68677-3-PBS. Standard:Eg0308. Range: 0.195-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 68677-2-Ig

  Biolayer interferometry (BLl) kinetic assays of 68677-2-Ig against Human FCGR3B were performed. The affinity constant is 1.86 nM.

FCGR3B/CD16b Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68677-2-PBS

Clone No.4E7D3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD16, CD16b, FCGR3B, Fc gamma RIII, Fc gamma RIII beta

---

Product Information

68677-2-PBS targets FCGR3B/CD16b as part of a matched antibody pair:

MP50059-1: 68677-1-PBS capture and 68677-2-PBS detection (validated in Sandwich ELISA)

MP50059-2: 68677-2-PBS capture and 68677-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0308

  Product name: Recombinant Human FCGR3B/CD16b protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 17-200 aa of NM_000570

  Sequence: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

• Full Name: Fc fragment of IgG, low affinity IIIb, receptor (CD16b)
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_000570
• Gene Symbol: FCGR3B
• Gene ID (NCBI): 2215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75015
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.