FCRL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FCRL2 Polyclonal antibody, PBS Only (33416-1-PBS)

• 

  WB analysis of HeLa using 33416-1-AP (same clone as 33416-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 33416-1-AP (FCRL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33416-1-PBS in a different storage buffer formulation.

FCRL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33416-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD307b, Fc receptor-like protein 2, FCRH2, FcR-like protein 2, IFGP4

---

Product Information

33416-1-PBS targets FCRL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg4773

  Product name: recombinant human CD307b/FCRL2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-401 aa of NM_030764.3

  Sequence: LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGV

• Full Name: Fc receptor-like 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_030764.3
• Gene Symbol: FCRL2
• Gene ID (NCBI): 79368
• RRID: AB_3742963
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96LA5-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.