FDFT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83020-1-RR (same clone as 83020-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83020-1-RR (FDFT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83020-1-RR (same clone as 83020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83020-1-RR (FDFT1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83020-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83020-1-RR (same clone as 83020-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FDFT1 antibody (83020-1-RR, Clone: 230362C10 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83020-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 83020-1-RR (same clone as 83020-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed L02 cells using FDFT1 antibody (83020-1-RR, Clone: 230362C10 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83020-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83020-1-RR (same clone as 83020-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Anti-Human FDFT1 (83020-1-RR, Clone:230362C10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83020-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83020-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83020-1-RR against Human FDFT1 were performed. The affinity constant is 0.126 nM.

FDFT1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83020-1-PBS

Clone No.230362C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230362C10, DGPT, EC:2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase

---

Product Information

83020-1-PBS targets FDFT1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3743

  Product name: Recombinant human SQS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-358 aa of BC029641

  Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK

• Full Name: farnesyl-diphosphate farnesyltransferase 1
• Calculated Molecular Weight: 417 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC029641
• Gene Symbol: FDFT1
• Gene ID (NCBI): 2222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37268
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SQS (Squalene synthase), also known as Farnesyl-diphosphate farnesyltransferase 1 (FDFT1) is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017).