FDX1L Polyclonal antibody

• 

  WB analysis using 32790-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32790-1-AP (FDX1L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FDX1L Polyclonal Antibody for WB, ELISA

Cat No. 32790-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Adrenodoxin-like protein, FDX2, Ferredoxin-1-like protein, Ferredoxin-2, mitochondrial

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletak muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32790-1-AP targets FDX1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37104

  Product name: Recombinant human FDX1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-183 aa of BC063460

  Sequence: IPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH

• Full Name: ferredoxin 1-like
• Calculated Molecular Weight: 183 aa, 20 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC063460
• Gene Symbol: FDX1L
• Gene ID (NCBI): 112812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P4F2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FDX1L (ferredoxin 1-like) is a gene encoding mitochondrial protein whose primary function is to participate in the biosynthesis of iron-sulfur clusters (Fe-S clusters). FDX1L is closely related to the assembly of iron-sulfur clusters and is the second component in the biosynthesis mechanism of iron-sulfur clusters. Studies have shown that FDX1L is widely expressed in human cells, especially in the central nervous system. In addition, mutations in FDX1L can lead to mitochondrial myopathy, manifested by a significant reduction in the activity of respiratory chain complexes I, II, and III. The function of FDX1L is different from that of FDX1 (ferredoxin 1). FDX1 is mainly involved in the synthesis of steroid hormones, while FDX1L focuses on the biosynthesis of iron-sulfur clusters. This functional difference allows FDX1L to play an important role in maintaining homeostasis of iron-sulfur clusters in the cell.