FEM1C Polyclonal antibody

• 

  WB analysis using 14037-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 14037-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 14037-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14037-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14037-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14037-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14037-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14037-1-AP (FEM1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 14037-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 14037-1-AP (FEM1C Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 14037-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14037-1-AP (FEM1C Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse brain using 14037-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14037-1-AP (FEM1C Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 14037-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 14037-1-AP (FEM1C Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 14037-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FEM1C antibody (14037-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

FEM1C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14037-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein fem-1 homolog C, FEM1-gamma, FEM1A, FEM1 gamma, FEM1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse heart tissue, HepG2 cells, rat brain tissue
• Positive IHC detected in: human heart tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14037-1-AP targets FEM1C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5099

  Product name: Recombinant human FEM1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 315-617 aa of BC028369

  Sequence: PDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHIPEKLETFVSLHR

• Full Name: fem-1 homolog c (C. elegans)
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC028369
• Gene Symbol: FEM1C
• Gene ID (NCBI): 56929
• RRID: AB_2878002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein fem-1 homolog C (FEM1C) is involved in protein modification and ubiquitination.Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit.Highly expressed in kidney, cardiac tissue, skeletal muscle and testis. Expressed at lower levels in other tissues, including cartilage.This antibody specifically recognizes the 69kd FEM1C protein.