Kindlin 3 Polyclonal antibody

• 

  WB analysis of Jurkat using 18131-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18131-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18131-1-AP (Kindlin 3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18131-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18131-1-AP (Kindlin 3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 18131-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 18131-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 18131-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 18131-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 18131-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 18131-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 18131-1-AP (FERMT3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 18131-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 18131-1-AP (FERMT3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of THP-1 using 18131-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using Kindlin 3 antibody (18131-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of Raji using 18131-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using Kindlin 3 antibody (18131-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Kindlin 3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18131-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FERMT3, KIND3, Kindlin-3, MIG 2, MIG2 like protein

---

Tested Applications

• Positive WB detected in: J774A.1 cells, Jurkat cells, Raji cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, K-562 cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

18131-1-AP targets Kindlin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12713

  Product name: Recombinant human FERMT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 321-663 aa of BC004347

  Sequence: DDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF

• Full Name: fermitin family homolog 3 (Drosophila)
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 72-76 kDa
• GenBank Accession Number: BC004347
• Gene Symbol: Kindlin 3/FERMT3
• Gene ID (NCBI): 83706
• RRID: AB_2103056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UX7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kindlin-3 (FERMT-3) is known to be central in hemostasis and thrombosis control and its deficiency disrupts platelet aggregation and causes Leukocyte Adhesion Deficiency disease. Point mutations in the kindlin-3 gene have been identified in humans with a rare inherited Integrin Activation efficiency Disease (IADD), also designated as Leukocyte Adhesion Deficiency syndrome (LAD-III or LADI variant). Kindlin-3 expression is restricted to cells of hematopoietic origin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	PLoS Biol; Non-muscle myosins control radial glial basal endfeet to mediate interneuron organization; Authors - Brooke R D'Arcy