Kindlin 3 Polyclonal antibody

Kindlin 3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18131-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FERMT3, KIND3, Kindlin-3, MIG 2, MIG2 like protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of Jurkat using 18131-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 18131-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18131-1-AP (Kindlin 3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 18131-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18131-1-AP (Kindlin 3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 18131-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 18131-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 18131-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 18131-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 18131-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 18131-1-AP (FERMT3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 18131-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma using 18131-1-AP (FERMT3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 18131-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma using 18131-1-AP (FERMT3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of THP-1 using 18131-1-AP
Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using Kindlin 3 antibody (18131-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of Raji using 18131-1-AP
Immunofluorescent analysis of (4% PFA) fixed Raji cells using Kindlin 3 antibody (18131-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Kindlin 3 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	J774A.1 cells, Jurkat cells, Raji cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, K-562 cells
Positive IHC detected in	human lymphoma tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	THP-1 cells, Raji cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18131-1-AP targets Kindlin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12713 Product name: Recombinant human FERMT3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 321-663 aa of BC004347 Sequence: DDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF Predict reactive species
Full Name	fermitin family homolog 3 (Drosophila)
Calculated Molecular Weight	76 kDa
Observed Molecular Weight	72-76 kDa
GenBank Accession Number	BC004347
Gene Symbol	Kindlin 3/FERMT3
Gene ID (NCBI)	83706
RRID	AB_2103056
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q86UX7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kindlin-3 (FERMT-3) is known to be central in hemostasis and thrombosis control and its deficiency disrupts platelet aggregation and causes Leukocyte Adhesion Deficiency disease. Point mutations in the kindlin-3 gene have been identified in humans with a rare inherited Integrin Activation efficiency Disease (IADD), also designated as Leukocyte Adhesion Deficiency syndrome (LAD-III or LADI variant). Kindlin-3 expression is restricted to cells of hematopoietic origin.

Protocols

Product Specific Protocols
IF protocol for Kindlin 3 antibody 18131-1-AP	Download protocol
IHC protocol for Kindlin 3 antibody 18131-1-AP	Download protocol
WB protocol for Kindlin 3 antibody 18131-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Kindlin 3 Polyclonal antibody (Cat# 18131-1-AP) has a total of 1 citation. This citation was published in PLoS Biology (2023), with an impact factor of 6.9. The study, titled "Non-muscle myosins control radial glial basal endfeet to mediate interneuron organization," falls within the neuroscience field, specifically investigating neurodevelopment and interneuron migration. The antibody was used for immunofluorescence (IF) in this publication.