FFAR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FFAR2 Polyclonal antibody (21765-1-AP)

FFAR2 Polyclonal Antibody for WB, ELISA

Cat No. 21765-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

FFA2, FFA2R, free fatty acid receptor 2, G protein coupled receptor 43, GPR43

• 

  WB analysis using 21765-1-AP

  Mouse colon tissue was subjected to SDS PAGE followed by western blot with 21765-1-AP (FFAR2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse colon tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21765-1-AP targets FFAR2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16367

  Product name: Recombinant human FFAR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 270-330 aa of BC096198

  Sequence: PLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE

• Full Name: free fatty acid receptor 2
• Calculated Molecular Weight: 330 aa, 37 kDa
• Observed Molecular Weight: 37-50 kDa
• GenBank Accession Number: BC096198
• Gene Symbol: FFAR2
• Gene ID (NCBI): 2867
• RRID: AB_3742056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15552
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Free fatty acid receptors (FFAR) play significant roles in various physiological processes through interaction with their ligands, fatty acids. Free fatty acid receptor 2 (FFAR2, also known as FFA2 or GPR43) is a receptor for short-chain fatty acids (SCFAs) and plays a role in the regulation of whole-body energy homeostasis and intestinal immunity (PMID: 12684041). It has been considered a therapeutic target for metabolic and inflammatory conditions (PMID: 23589301). FFAR2 has a calculated molecular weight of 37 kDa and can be glycosylated. The higher apparent molecular weight of 50 kDa has been reported, probably due to glycosylation (PMID: 31707282; 28131568).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,ELISA	Mol Nutr Food Res; Monascus pilosus SWM-008-Fermented Red Mold Rice and Its Monascinol Ameliorate Non-Alcoholic Fatty Liver Disease via Activation of the AMPK-ATGL Pathway and Enrichment of Butyrate-Producing Bacteria.; Authors - Chia-Pei Hsieh