Product Information
83296-4-PBS targets FGD6 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag22211 Product name: Recombinant human FGD6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 289-348 aa of BC013319 Sequence: ACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPS Predict reactive species |
| Full Name | FYVE, RhoGEF and PH domain containing 6 |
| Calculated Molecular Weight | 1430 aa, 161 kDa |
| GenBank Accession Number | BC013319 |
| Gene Symbol | FGD6 |
| Gene ID (NCBI) | 55785 |
| RRID | AB_3670963 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q6ZV73 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FGD6, also known as ZFYVE24, is localized on the Homo sapiens chromosome 12q22 and consists of 1,400 amino acids. Previous studies have reported that variations in FGD6 increase individual susceptibility to polypoidal choroidal vasculopathy. It was also demonstrated that FGD6 coordinates cell polarity and endosomal membrane recycling in osteoclasts by regulating the assembly of different actin-based protein networks and activating Cdc42 at different locations.



