Filter: AllIHC

IHC staining of human placenta using 26698-1-AP (same clone as 26698-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26698-1-AP (FGF7 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26698-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 26698-1-AP (same clone as 26698-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26698-1-AP (FGF7 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26698-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 26698-1-AP (same clone as 26698-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 26698-1-AP (FGF7 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26698-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 26698-1-AP (same clone as 26698-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 26698-1-AP (FGF7 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26698-1-PBS in a different storage buffer formulation.

FGF-7/KGF Polyclonal antibody, PBS Only

Name: FGF-7/KGF Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26698-1-PBS

FGF-7/KGF Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26698-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

FGF7, FGF-7, FGF 7, Fibroblast growth factor 7, HBGF-7

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

26698-1-PBS targets FGF-7/KGF in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag24903 Product name: Recombinant human FGF7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-97 aa of BC010956 Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGEDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYSK Predict reactive species
Full Name	fibroblast growth factor 7 (keratinocyte growth factor)
Calculated Molecular Weight	22-28 kDa
GenBank Accession Number	BC010956
Gene Symbol	FGF7
Gene ID (NCBI)	2252
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P21781
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.