FGF10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FGF10 Polyclonal antibody, PBS Only (29749-1-PBS)

• 

  WB analysis using 29749-1-AP (same clone as 29749-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29749-1-AP (FGF10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29749-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 29749-1-AP (same clone as 29749-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using FGF10 antibody (29749-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29749-1-PBS in a different storage buffer formulation.

FGF10 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 29749-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

---

Product Information

29749-1-PBS targets FGF10 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31278

  Product name: Recombinant human FGF10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-150 aa of BC105021

  Sequence: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC

• Full Name: fibroblast growth factor 10
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC105021
• Gene Symbol: FGF10
• Gene ID (NCBI): 2255
• RRID: AB_2918343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FGF10 belongs to the FGF7 subfamily. FGF10 is a paracrine signaling growth factor of 215 amino acids with a typical signal sequence for secretion and plays an essential role during development and tissue homeostasis in adults (PMID: 30405705). FGF10 is mainly produced by neuron and microglia/macrophages (PMID: 28981091). The calculated molecular weight of FGF10 is 23 kDa. Sometimes higher molecular weight around 40 kDa can also be observed, which may be a modified variant of FGF10.