Tested Applications
| Positive IHC detected in | mouse heart tissue, mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11495-1-AP targets FGF18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2041 Product name: Recombinant human FGF18 protein Source: e coli.-derived, PKG Tag: GST Domain: 1-207 aa of BC006245 Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA Predict reactive species |
| Full Name | fibroblast growth factor 18 |
| Calculated Molecular Weight | 207 aa, 24 kDa |
| GenBank Accession Number | BC006245 |
| Gene Symbol | FGF18 |
| Gene ID (NCBI) | 8817 |
| RRID | AB_2877770 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O76093 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FGF18 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FGF18 antibody 11495-1-AP | Download protocol |
| IHC protocol for FGF18 antibody 11495-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FGF18 antibody (Cat# 11495-1-AP) has 9 total citations across journals including J Nanobiotechnology, J Exp Clin Cancer Res, Cell Mol Biol Lett, Adv Healthc Mater, Antioxid Redox Signal, Life Sci, Front Bioeng Biotechnol, Front Pharmacol, and Ann Transl Med. Research fields span osteoarthritis/cartilage biology, non-small cell lung cancer, gastric cancer, periodontal ligament stem cell differentiation, hepatic ischemia/reperfusion injury, and hair growth regulation.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Delivery of FGF18 using mRNA-LNP protects the cartilage against degeneration via alleviating chondrocyte senescence | ||
J Exp Clin Cancer Res HDAC7 promotes NSCLC proliferation and metastasis via stabilization by deubiquitinase USP10 and activation of β-catenin-FGF18 pathway. | ||
Cell Mol Biol Lett The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs. | ||
Adv Healthc Mater Targeted Therapy of Osteoarthritis via Intra-Articular Delivery of Lipid-Nanoparticle-Encapsulated Recombinant Human FGF18 mRNA | ||
Antioxid Redox Signal Remifentanil Mitigates Hepatic Ischemia/Reperfusion-Induced D1-Medium Spiny Neurons Damage via Fibroblast Growth Factor 18 Upregulation | ||
Life Sci BUB1 potentiates gastric cancer proliferation and metastasis by activating TRAF6/NF-κB/FGF18 through m6A modification |









