FGF18 Monoclonal antibody, PBS Only

FGF18 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60341-1-PBS
Clone No.1D11D12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rabbit

Applications

WB, Indirect ELISA

FGF 18, FGF18, fibroblast growth factor 18, ZFGF5

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60341-1-PBS targets FGF18 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rabbit samples.

Tested Reactivity human, mouse, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2041

Product name: Recombinant human FGF18 protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-207 aa of BC006245

Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

Predict reactive species
Full Name fibroblast growth factor 18
Calculated Molecular Weight 207 aa, 24 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC006245
Gene Symbol FGF18
Gene ID (NCBI) 8817
RRIDAB_2881450
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO76093
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FGF18 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures.

Loading...
||
New chat Able
正在加载,请稍候...