FGFR1OP Monoclonal antibody

• 

  WB analysis using 67207-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67207-1-Ig (FGFR1OP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67207-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67207-1-Ig (FGFR1OP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of BT-549 using 67207-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed BT-549 cells using FGFR1OP antibody (67207-1-Ig, Clone: 1F1D8 ) at dilution of 1:2400 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

FGFR1OP Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67207-1-Ig

Clone No.1F1D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Centrosomal protein 43, CEP43, FGFR1 oncogene partner, FOP

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cels, K-562 cells, U2OS cells
• Positive IF/ICC detected in: BT-549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1200-1:4800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67207-1-Ig targets FGFR1OP in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28671

  Product name: Recombinant human FGFR1OP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-374 aa of BC011902

  Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY

• Full Name: FGFR1 oncogene partner
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC011902
• Gene Symbol: FGFR1OP
• Gene ID (NCBI): 11116
• RRID: AB_2882500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FGFR1OP, also named as FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia.