Anti-Human FGFR3 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human FGFR3 Rabbit Recombinant Antibody (98631-2-RR)

FGFR3 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98631-2-RR

Clone No.251774D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

ACH, CD333, CEK2, FGFR 3, HSFGFR3EX

• 

  FC experiment of K562 using 98631-2-RR

  1x10^6 K562 were surface stained with 0.25 ug Anti-Human FGFR3 Rabbit RecAb (98631-2-RR, Clone: 251774D11) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: K562 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98631-2-RR targets FGFR3 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1040

  Product name: Recombinant Human FGFR3(IIIc) protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-375 aa of

  Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

• Full Name: fibroblast growth factor receptor 3
• Calculated Molecular Weight: 88kd
• Gene Symbol: FGFR3
• Gene ID (NCBI): 2261
• RRID: AB_3746230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22607-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Fibroblast growth factors (FGFs) are polypeptide growth factors involved in a variety of activities including mitogenesis, angiogenesis, and wound healing (PMID: 1847508). The human FGF receptor family, a subfamily of receptor tyrosine kinases (RTKs), comprises of four family members-FGFR1, FGFR2, FGFR3, and FGFR4 (PMID: 23900974). Each receptor contains an extracellular domain with either two or three immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tyrosine kinase domain. FGFR3 binds acidic and basic fibroblast GH and plays a role in bone development and maintenance. Mutations in the FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia. Due to frequent mutations in certain cancers, the FGFR3 gene has also been associated with tumor progression.