FGR Polyclonal antibody

• 

  WB analysis using 31641-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31641-1-AP (FGR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 31641-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using FGR antibody (31641-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FGR Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31641-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Proto oncogene c Fgr, p58c fgr, p55c fgr, p55 Fgr, c src2

---

Tested Applications

• Positive WB detected in: HL-60 cells, Raji cells
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31641-1-AP targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34944

  Product name: Recombinant human FGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of NM_005248

  Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

• Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: NM_005248
• Gene Symbol: FGR
• Gene ID (NCBI): 2268
• RRID: AB_3670061
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P09769
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FGR (Tyrosine-protein kinase Fgr), a member of the Src family of tyrosine kinases, is highly expressed in many cancers and can regulate mitochondrial oxidative phosphorylation (PMID: 37475042).