FGR Polyclonal antibody

FGR Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 31641-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Proto oncogene c Fgr, p58c fgr, p55c fgr, p55 Fgr, c src2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, Raji cells
Positive IF/ICC detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31641-1-AP targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34944

Product name: Recombinant human FGR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-90 aa of NM_005248

Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

Predict reactive species
Full Name Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Calculated Molecular Weight59 kDa
Observed Molecular Weight59 kDa
GenBank Accession NumberNM_005248
Gene Symbol FGR
Gene ID (NCBI) 2268
RRIDAB_3670061
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP09769
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FGR (Tyrosine-protein kinase Fgr), a member of the Src family of tyrosine kinases, is highly expressed in many cancers and can regulate mitochondrial oxidative phosphorylation (PMID: 37475042).

Protocols

Product Specific Protocols
IF protocol for FGR antibody 31641-1-APDownload protocol
WB protocol for FGR antibody 31641-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...