Tested Applications
| Positive WB detected in | Daudi cells, Raji cells |
| Positive IF/ICC detected in | Raji cells |
| Positive FC (Intra) detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83352-1-RR targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34944 Product name: Recombinant human FGR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of NM_005248 Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA Predict reactive species |
| Full Name | Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | NM_005248 |
| Gene Symbol | FGR |
| Gene ID (NCBI) | 2268 |
| RRID | AB_3671010 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P09769 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FGR (Tyrosine-protein kinase Fgr) is a member of the Src family of protein tyrosine kinases (PTKs). It's contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FGR antibody 83352-1-RR | Download protocol |
| IF protocol for FGR antibody 83352-1-RR | Download protocol |
| WB protocol for FGR antibody 83352-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







