CoraLite® Plus 488-conjugated FGR Recombinant monoclonal antibody

• 

  IF Staining of Raji using CL488-83352

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CoraLite® Plus 488 FGR antibody (CL488-83352, Clone: 240275E5 ) at dilution of 1:200.

FGR Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83352

Clone No.240275E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

c fgr, c src2, p55 Fgr, p55c fgr, p58c fgr

---

Tested Applications

• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83352 targets FGR in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34944

  Product name: Recombinant human FGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of NM_005248

  Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

• Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_005248
• Gene Symbol: FGR
• Gene ID (NCBI): 2268
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09769
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FGR (Tyrosine-protein kinase Fgr) is a member of the Src family of protein tyrosine kinases (PTKs). It's contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.