FGR Recombinant monoclonal antibody, PBS Only (Capture)

FGR Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83352-1-PBS
Clone No.240275E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

240275E5, c fgr, c src2, p55 Fgr, p55c fgr

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83352-1-PBS targets FGR as part of a matched antibody pair:

MP00370-1: 83352-1-PBS capture and 83352-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34944

Product name: Recombinant human FGR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-90 aa of NM_005248

Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

Predict reactive species
Full Name Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Calculated Molecular Weight59 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberNM_005248
Gene Symbol FGR
Gene ID (NCBI) 2268
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09769
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FGR (Tyrosine-protein kinase Fgr) is a member of the Src family of protein tyrosine kinases (PTKs). It's contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.

Loading...
||
New chat

Able

正在加载,请稍候...