FHIT Monoclonal antibody

FHIT Monoclonal Antibody for ELISA
Cat No. 66086-1-Ig
Clone No.4D6G1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

AP3A hydrolase, AP3Aase, Bis(5 adenosyl) triphosphatase, Dinucleosidetriphosphatase, FHIT, FRA3B, fragile histidine triad gene

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66086-1-Ig targets FHIT in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14471

Product name: Recombinant human FHIT protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-147 aa of BC032336

Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Predict reactive species
Full Name fragile histidine triad gene
Calculated Molecular Weight 147 aa, 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC032336
Gene Symbol FHIT
Gene ID (NCBI) 2272
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49789
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The candidate tumor suppressor gene, FHIT(Fragile histidine triad protein), encompasses the common human chromosomal fragile site at 3p14.2, the hereditary renal cancer translocation breakpoint, and cancer cell homozygous deletions. Fhit hydrolyzes dinucleotide 5',5'''-P1,P3-triphosphate in vitro and mutation of a central histidine abolishes hydrolase activity(PMID:9391102). FHIT has a major role in regulating beta-catenin-mediated gene transcription.

Protocols

Product Specific Protocols
WB protocol for FHIT antibody 66086-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancer Biomark

FHIT and C-MYC expression in cervical histology and cytology as biomarkers for detecting high-grade intraepithelial neoplasia in human papillomavirus-positive women.

Authors - Fan Yang
humanIHC,WB

Int J Clin Exp Pathol

Upregulation of FHIT gene expression in endometrial carcinoma by RNA activation.

Authors - Qing Zhu
Loading...
||
New chat Able
正在加载,请稍候...