• Featured Product
  • KD/KO Validated

FHL3 Polyclonal antibody

FHL3 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 11028-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ELISA

FHL 3, FHL3, four and a half LIM domains 3, Skeletal muscle LIM protein 2, SLIM 2, SLIM2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, mouse ovary tissue
Positive IP detected inK-562 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11028-2-AP targets FHL3 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1495

Product name: Recombinant human FHL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-280 aa of BC011697

Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Predict reactive species
Full Name four and a half LIM domains 3
Calculated Molecular Weight 31 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC011697
Gene Symbol FHL3
Gene ID (NCBI) 2275
RRIDAB_2294066
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13643
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479). This antibody recognizes specifically the 34kd FHL3 protein.

Protocols

Product Specific Protocols
WB protocol for FHL3 antibody 11028-2-APDownload protocol
IHC protocol for FHL3 antibody 11028-2-APDownload protocol
IP protocol for FHL3 antibody 11028-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

J Clin Invest

RNA-binding protein PCBP2 modulates glioma growth by regulating FHL3.

Authors - Han Wei W
humanWB

Nat Commun

A signature motif in LIM proteins mediates binding to checkpoint proteins and increases tumour radiosensitivity.

Authors - Xiaojie Xu
humanWB,IP

Cell Death Differ

FHL3 links cell growth and self-renewal by modulating SOX4 in glioma.

Authors - Wei Han
  • KD Validated
humanWB,IHC,IF

Aging (Albany NY)

FHL3 promotes pancreatic cancer invasion and metastasis through preventing the ubiquitination degradation of EMT associated transcription factors.

Authors - Pengping Li
  • KD Validated
humanWB

J Virol

The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein.

Authors - McCabe áine á
humanIF

Front Oncol

FHL3 Contributes to EMT and Chemotherapy Resistance Through Up-Regulation of Slug and Activation of TGFβ/Smad-Independent Pathways in Gastric Cancer.

Authors - Guodong Cao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marina (Verified Customer) (03-24-2025)

80 micrograms of cell lysate (U-373 MG cells). Antibody dilution 1:500, overnight incubation at 4 degrees

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Glioblastoma cell line
FHL3 Antibody Western Blot validation (1:500 dilution) in Glioblastoma cell line (Cat no:11028-2-AP)
Loading...
||
New chat Able
正在加载,请稍候...