Tested Applications
| Positive WB detected in | K-562 cells, mouse ovary tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11028-2-AP targets FHL3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1495 Product name: Recombinant human FHL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC011697 Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP Predict reactive species |
| Full Name | four and a half LIM domains 3 |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 31-34 kDa |
| GenBank Accession Number | BC011697 |
| Gene Symbol | FHL3 |
| Gene ID (NCBI) | 2275 |
| RRID | AB_2294066 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13643 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FHL3 antibody 11028-2-AP | Download protocol |
| IP protocol for FHL3 antibody 11028-2-AP | Download protocol |
| WB protocol for FHL3 antibody 11028-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-FHL3 antibody (Cat# 11028-2-AP) has 12 citations across journals including Nature Communications, Journal of Clinical Investigation, Cell Death & Differentiation, NPJ Precision Oncology, BMC Cancer, Journal of Virology, Frontiers in Oncology, PLoS One, Gene, and Aging. Research fields span cancer biology (glioma, pancreatic, prostate, gastric, and colorectal cancer), EMT and chemotherapy resistance, protein–protein interactions, angiogenesis, and virology. Applications cited include WB, IHC, IF, and IP.
| Species | Application | Title |
|---|---|---|
Nat Commun A signature motif in LIM proteins mediates binding to checkpoint proteins and increases tumour radiosensitivity. | ||
Cell Death Differ FHL3 links cell growth and self-renewal by modulating SOX4 in glioma.
| ||
NPJ Precis Oncol High-throughput proteomics profiling-derived signature associated with chemotherapy response and survival for stage II/III colorectal cancer | ||
Aging (Albany NY) FHL3 promotes pancreatic cancer invasion and metastasis through preventing the ubiquitination degradation of EMT associated transcription factors.
| ||
J Virol The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein. |
Reviews
What customers say
The single review reports using this antibody for Western Blot on a glioblastoma cell line (U-373 MG). The reviewer loaded 80 micrograms of cell lysate and applied a 1:500 dilution with overnight incubation at 4 degrees. The product received a moderate rating of 3 out of 5, suggesting acceptable but not outstanding performance under these conditions. Overall, the feedback indicates the antibody works for WB detection in glioblastoma cells at the stated dilution, though results were only satisfactory rather than exceptional.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marina (Verified Customer) (03-24-2025) | 80 micrograms of cell lysate (U-373 MG cells). Antibody dilution 1:500, overnight incubation at 4 degrees
 |
