FHL5 Polyclonal antibody

• 

  WB analysis of mouse heart using 12650-2-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12650-2-AP (FHL5 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 12650-2-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12650-2-AP (FHL5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 12650-2-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12650-2-AP (FHL5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12650-2-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12650-2-AP (FHL5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

FHL5 Polyclonal Antibody for WB, ELISA

Cat No. 12650-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ACT, Activator of CREM in testis, FHL 5, FHL5, four and a half LIM domains 5, RP3 393D12.2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12650-2-AP targets FHL5 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3364

  Product name: Recombinant human FHL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-284 aa of BC021723

  Sequence: YCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI

• Full Name: four and a half LIM domains 5
• Calculated Molecular Weight: 284 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC021723
• Gene Symbol: FHL5
• Gene ID (NCBI): 9457
• RRID: AB_2104496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TD97
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.