FHOD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FHOD1 Polyclonal antibody (33972-1-AP)

• 

  WB analysis using 33972-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33972-1-AP (FHOD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FHOD1 Polyclonal Antibody for WB, ELISA

Cat No. 33972-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FH1/FH2 domain-containing protein 1, FHOS, FHOS1, Formin homolog overexpressed in spleen 1, Formin homology 2 domain-containing protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33972-1-AP targets FHOD1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38590

  Product name: Recombinant human FHOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_013241.2

  Sequence: MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDK

• Full Name: formin homology 2 domain containing 1
• Calculated Molecular Weight: 127kDa，1164aa
• Observed Molecular Weight: 125 kDa
• GenBank Accession Number: NM_013241.2
• Gene Symbol: FHOD1
• Gene ID (NCBI): 29109
• RRID: AB_3743128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FHOD1 (Formin homology 2 domain-containing protein 1) is a member of the Diaphanous-related formins (DRFs), a family of proteins characterized by the presence of a GTP-binding domain (GBD), formin homology (FH) 1 and FH2 domains, a coiled-coil motif, and a diaphanous autoregulatory domain (DAD). Accumulating evidence indicates that FHOD1 not only modulates intracellular signaling pathways in tumor cells but also influences multiple components of the tumor microenvironment (TME), including T cells, B cells, cancer-associated fibroblasts (CAFs), and various cytokines. Dysregulated expression and functional impairment of FHOD1 have been implicated in the development of tumor immunosuppression. Specifically, FHOD1 interferes with the function of chemokine receptors responsible for guiding immune cell trafficking to tumor sites, thereby compromising the efficient infiltration of immune cells into the TME. This deficiency limits the capacity of immune cells to target and eliminate tumor cells. Furthermore, FHOD1 aberrantly activates intracellular signaling pathways within immune cells, impairing their ability to recognize and respond to tumor cells effectively. Consequently, FHOD1 contributes to an immunosuppressive TME, creating a permissive environment for tumor progression and metastasis (PMID: 40364836).