FIBIN Polyclonal antibody

FIBIN Polyclonal Antibody for IHC, ELISA
Cat No. 27051-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

FIBIN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27051-1-AP targets FIBIN in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24265

Product name: Recombinant human FIBIN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-98 aa of BC026873

Sequence: YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVL

Predict reactive species
Full Name fin bud initiation factor homolog (zebrafish)
Calculated Molecular Weight 211 aa, 24 kDa
GenBank Accession NumberBC026873
Gene Symbol FIBIN
Gene ID (NCBI) 387758
RRIDAB_2880733
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TAL6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for FIBIN antibody 27051-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...