FIBIN Polyclonal antibody

• 

  IHC staining of human brain using 27051-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27051-1-AP (FIBIN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 27051-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27051-1-AP (FIBIN Antibody) at dilution of 1:200 (under 40x lens).

FIBIN Polyclonal Antibody for IHC, ELISA

Cat No. 27051-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

FIBIN

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27051-1-AP targets FIBIN in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24265

  Product name: Recombinant human FIBIN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-98 aa of BC026873

  Sequence: YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVL

• Full Name: fin bud initiation factor homolog (zebrafish)
• Calculated Molecular Weight: 211 aa, 24 kDa
• GenBank Accession Number: BC026873
• Gene Symbol: FIBIN
• Gene ID (NCBI): 387758
• RRID: AB_2880733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.