FIG4 Polyclonal antibody

• 

  WB analysis using 28499-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28499-1-AP (FIG4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FIG4 Polyclonal Antibody for WB, ELISA

Cat No. 28499-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA0274, hSac3, FIG4 homolog (S. cerevisiae), EC:3.1.3.16, EC:3.1.3.-

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NIH/3T3 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28499-1-AP targets FIG4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28971

  Product name: Recombinant human FIG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 654-792 aa of BC041338

  Sequence: VNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTE

• Full Name: FIG4 homolog (S. cerevisiae)
• Calculated Molecular Weight: 907 aa, 104 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC041338
• Gene Symbol: FIG4
• Gene ID (NCBI): 9896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92562
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FIG4 (also named SAC3) is a 5'-phosphoinositide phosphatase that coordinates the turnover of phosphatidylinositol-3,5-bisphosphate (PI(3,5)P2), a very low abundance phosphoinositide. Deficiency of FIG4 severely affects the human and mouse nervous systems by causing two distinct forms of abnormal lysosomal storage (PMID: 23165282).