FIS1 Monoclonal antibody, PBS Only (Detector)

FIS1 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 66635-3-PBS
Clone No.3E4A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66635-3-PBS targets FIS1 as part of a matched antibody pair:

MP50498-1: 66635-2-PBS capture and 66635-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1409

Product name: Recombinant human FIS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC009428

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Predict reactive species
Full Name fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC009428
Gene Symbol FIS1
Gene ID (NCBI) 51024
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G Magarose purification
UNIPROT IDQ9Y3D6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...