FIS1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82248-1-RR (same clone as 82248-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82248-1-RR (FIS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 82248-1-RR (same clone as 82248-1-PBS)

  IP result of anti-FIS1 (IP:82248-1-RR, 4ug; Detection:82248-1-RR 1:5000) with HeLa cells lysate 1720 ug. This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 82248-1-RR (same clone as 82248-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82248-1-RR (FIS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 82248-1-RR (same clone as 82248-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 82248-1-RR (FIS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82248-1-RR (same clone as 82248-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FIS1 antibody (82248-1-RR, Clone: 6N15 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82248-1-RR (same clone as 82248-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human FIS1 (82248-1-RR, Clone:6N15) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82248-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82248-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82248-1-RR against Human FIS1 were performed. The affinity constant is 0.251 nM.

FIS1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 82248-1-PBS

Clone No.6N15

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

TPR repeat protein 11, hFis1, FIS1 homolog, CGI-135, CGI 135

---

Product Information

82248-1-PBS targets FIS1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1409

  Product name: Recombinant human FIS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC009428

  Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

• Full Name: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009428
• Gene Symbol: FIS1
• Gene ID (NCBI): 51024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3D6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (PMID: 21257639, 21459773, 23333625)