FKBP1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FKBP1B Polyclonal antibody (15114-1-AP)

• KD/KO Validated

FKBP1B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15114-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

12.6 kDa FK506-binding protein, EC:5.2.1.8, FK506-binding protein 1B, FKBP 1B, FKBP-12.6

• 

  WB analysis of U-937 using 15114-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15114-1-AP

  WB result of FKBP1B antibody (15114-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP1B transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15114-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15114-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 15114-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15114-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 15114-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 15114-1-AP (FKBP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 15114-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15114-1-AP (FKBP1B antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 15114-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15114-1-AP (FKBP1B antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FKBP1B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-937 cells, Jurkat cells, mouse brain tissue, mouse heart tissue, HepG2 cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15114-1-AP targets FKBP1B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7153

  Product name: Recombinant human FKBP1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC002614

  Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC

• Full Name: FK506 binding protein 1B, 12.6 kDa
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC002614
• Gene Symbol: FKBP1B
• Gene ID (NCBI): 2281
• RRID: AB_11182817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P68106
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FKBP1B Polyclonal antibody (catalog number 15114-1-AP) has a total of 2 citations. These appear in the journals Neuron and International Journal of Molecular Sciences. The associated research fields include Alzheimer's disease (autosomal dominant profile and disease protection mechanisms, using IF in human samples) and stress-induced myocardial damage (FKBP12.6 ubiquitination, calcium homeostasis, and mitochondrial quality control, using WB in mouse samples).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Neuron; Single-nucleus RNA sequencing demonstrates an autosomal dominant Alzheimer's disease profile and possible mechanisms of disease protection; Authors - Maria Camila Almeida
mouse	WB	Int J Mol Sci; NR3C1/GLMN-Mediated FKBP12.6 Ubiquitination Disrupts Calcium Homeostasis and Impairs Mitochondrial Quality Control in Stress-Induced Myocardial Damage.; Authors - Jingze Cong