Tested Applications
| Positive WB detected in | K-562 cells, HEK-293 cells, mouse thymus tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human colon cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14155-1-AP targets FKBP5 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5337 Product name: Recombinant human FKBP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-375 aa of BC042605 Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE Predict reactive species |
| Full Name | FK506 binding protein 5 |
| Calculated Molecular Weight | 457 aa, 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC042605 |
| Gene Symbol | FKBP5 |
| Gene ID (NCBI) | 2289 |
| RRID | AB_2231625 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13451 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FKBP5 antibody 14155-1-AP | Download protocol |
| IP protocol for FKBP5 antibody 14155-1-AP | Download protocol |
| WB protocol for FKBP5 antibody 14155-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
FKBP51 antibody (Cat# 14155-1-AP) has 36 citations across journals including Nature Immunology, Cell Stem Cell, EMBO Journal, Advanced Science, Frontiers in Immunology, and Cell Molecular Life Science. Research fields span neuroinflammation, microglial biology, depression, epilepsy, stroke, cancer, diabetic kidney disease, rheumatoid arthritis, sepsis, osteoarthritis, and asthma, with applications primarily in WB, IF, IHC, and CoIP.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Decoding the temporal and regional specification of microglia in the developing human brain. | ||
Adv Sci (Weinh) IRF4 in Skeletal Muscle Regulates Exercise Capacity via PTG/Glycogen Pathway. | ||
Phytomedicine Baicalin alleviates lipid metabolism disorders in diabetic kidney disease via targeting FKBP51 | ||
EMBO J USP49 negatively regulates tumorigenesis and chemoresistance through FKBP51-AKT signaling.
| ||
Brain Behav Immun Inhibition of the NFATc2/FKBP5 axis alleviates microglial neuroinflammation by regulating arachidonic acid metabolism in Parkinson's disease. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The reviewer used the antibody for Western Blot on macrophages at a 1:3000 dilution and described it as "highly recommend," indicating strong performance and satisfaction with the results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sonam (Verified Customer) (10-02-2025) | Highly recommend
|
