FKBP5 Recombinant monoclonal antibody, PBS Only (Detector)

FKBP5 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 86189-2-PBS
Clone No.250798G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

FKBP-51, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6, Androgen-regulated protein 6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86189-2-PBS targets FKBP5 as part of a matched antibody pair:

MP02289-1: 86189-3-PBS capture and 86189-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5337

Product name: Recombinant human FKBP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-375 aa of BC042605

Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Predict reactive species
Full Name FK506 binding protein 5
Calculated Molecular Weight 457 aa, 51 kDa
Observed Molecular Weight51 kDa
GenBank Accession NumberBC042605
Gene Symbol FKBP5
Gene ID (NCBI) 2289
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13451
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).

Loading...
||
New chat Able
正在加载,请稍候...