FKBP5 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sample test of MP02289-1

  The mean FKBP5 concentration was determined to be 473.3 ng/mL in K-562 cell extract based on a 3.00 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02289-1

  Cytometric bead array standard curve of MP02289-1, FKBP5 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86189-3-PBS. Detection antibody: 86189-2-PBS. Standard: Ag5337. Range: 1.563-200 ng/mL.

FKBP5 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA, Sample test

Cat No. 86189-3-PBS

Clone No.250798C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA, Sample test

Synonyms

FKBP-51, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6, Androgen-regulated protein 6

---

Product Information

86189-3-PBS targets FKBP5 as part of a matched antibody pair:

MP02289-1: 86189-3-PBS capture and 86189-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5337

  Product name: Recombinant human FKBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-375 aa of BC042605

  Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

• Full Name: FK506 binding protein 5
• Calculated Molecular Weight: 457 aa, 51 kDa
• GenBank Accession Number: BC042605
• Gene Symbol: FKBP5
• Gene ID (NCBI): 2289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13451
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.