FKBP7 Polyclonal antibody

• 

  WB analysis of human lung using 12092-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12092-1-AP (FKBP7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12092-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12092-1-AP (FKBP7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 12092-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12092-1-AP (FKBP7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 12092-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12092-1-AP (FKBP7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 12092-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12092-1-AP (FKBP7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 12092-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12092-1-AP (FKBP7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FKBP7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12092-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

23 kDa FK506 binding protein, 23 kDa FK506-binding protein, 23 kDa FKBP, EC:5.2.1.8, FK506 binding protein 7

---

Tested Applications

• Positive WB detected in: human lung tissue, human heart tissue
• Positive IHC detected in: human liver cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12092-1-AP targets FKBP7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2733

  Product name: Recombinant human FKBP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC009711

  Sequence: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

• Full Name: FK506 binding protein 7
• Calculated Molecular Weight: 259 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009711
• Gene Symbol: FKBP7
• Gene ID (NCBI): 51661
• RRID: AB_2103418
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y680
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP7(FK506-binding protein 7) is also named as FKBP23 and belongs to immunophilin class of proteins family. This protein contains an N-terminal hydrophobic signal sequence, a PPIase motif, 2 EF-hand domains, and 2 putative N-glycosylation sites. The calculated molecular mass is about 25 kD, but becomes 33 kD following cleavage of the signal sequence(PMID:9806833). It could bind to BiP in ER in a process regulated by the concentration of Ca2+(PMID:22269648). It has 3 isoforms produced by alternative splicing.