FKBP8 Polyclonal antibody

• 

  WB analysis of HeLa using 11173-1-AP

  WB result of FKBP8 antibody (11173-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells.

• 

  WB analysis using 11173-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11173-1-AP

  WB result of FKBP8 antibody (11173-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells.

• 

  WB analysis of mouse brain using 11173-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11173-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 11173-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 11173-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 11173-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11173-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11173-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11173-1-AP

  IP result of anti-FKBP8 (IP:11173-1-AP, 4ug; Detection:11173-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IF Staining of SH-SY5Y using 11173-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 11173-1-AP (FKBP8 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FKBP8 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11173-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

FKBP-38, FKBP38, FKBP 8, FKBP 38, FK506-binding protein 8

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, SH-SY5Y cells, mouse brain tissue, mouse pancreas tissue, Jurkat cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

11173-1-AP targets FKBP8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1649

  Product name: Recombinant human FKBP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC009966

  Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

• Full Name: FK506 binding protein 8, 38kDa
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC009966
• Gene Symbol: FKBP8
• Gene ID (NCBI): 23770
• RRID: AB_10597097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Elife; ZMYND10 functions in a chaperone relay during axonemal dynein assembly.; Authors - Girish R Mali
human		Front Bioeng Biotechnol; Efficient and reversible Cas13d-mediated knockdown with an all-in-one lentivirus-vector; Authors - Suli Lv ; KO Validated
rat	IF	Int J Mol Sci; Analysis of Dysferlin Direct Interactions with Putative Repair Proteins Links Apoptotic Signaling to Ca2+ Elevation via PDCD6 and FKBP8; Authors - Dennis G Drescher
human	WB	J Biol Chem; Lysine demethylase KDM1A promotes cell growth via FKBP8-BCL2 axis in hepatocellular carcinoma; Authors - Suli Lv ; KO Validated
human	WB	Mol Hum Reprod; Comprehensive analysis of ovarian granulosa cell proteomics and phosphoproteomics in PCOS patients without insulin resistance; Authors - Xiao Yang
human	WB	Cell Chem Biol; Integrative proximal-ubiquitomics profiling for deubiquitinase substrate discovery applied to USP30; Authors - Andreas Damianou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Chun (Verified Customer) (06-19-2022)

This antibody worked well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1,000
• Cell Tissue Type: HeLa cells