FKBP8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FKBP8 Polyclonal antibody (11173-1-AP)

• Featured Product
• KD/KO Validated

FKBP8 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11173-1-AP Copied!

Publications (10)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

FK506 binding protein 8, FK506-binding protein 8, FKBP 38, FKBP 8, FKBP38

• 

  WB analysis of HeLa using 11173-1-AP

  WB result of FKBP8 antibody (11173-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11173-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11173-1-AP

  WB result of FKBP8 antibody (11173-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11173-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 11173-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 11173-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 11173-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 11173-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11173-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 11173-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11173-1-AP

  IP result of anti-FKBP8 (IP:11173-1-AP, 4ug; Detection:11173-1-AP 1:500) with HeLa cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 11173-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FKBP8 antibody (11173-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FKBP8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, SH-SY5Y cells, mouse brain tissue, mouse pancreas tissue, Jurkat cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11173-1-AP targets FKBP8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1649

  Product name: Recombinant human FKBP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC009966

  Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

• Full Name: FK506 binding protein 8, 38kDa
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC009966
• Gene Symbol: FKBP8
• Gene ID (NCBI): 23770
• RRID: AB_10597097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.

Publications

What published studies show

Able is busy answering your previous question. Please try again later.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomaterials; A modular design of two-pronged sub-organelle targeting strategy disrupting mitochondria-endoplasmic reticulum crosstalk for mitigating rheumatoid arthritis.; Authors - Jianheng Ren
human	WB	Cell Chem Biol; Integrative proximal-ubiquitomics profiling for deubiquitinase substrate discovery applied to USP30; Authors - Andreas Damianou
human		Front Bioeng Biotechnol; Efficient and reversible Cas13d-mediated knockdown with an all-in-one lentivirus-vector; Authors - Suli Lv ; KO Validated
rat	IF	Int J Mol Sci; Dysferlin Protein-Protein Interaction Pathways in the Organ of Corti and Spiral Ganglion Intersect with Alzheimer's Protein Pathways.; Authors - Marian J. Drescher
rat	IF	Int J Mol Sci; Analysis of Dysferlin Direct Interactions with Putative Repair Proteins Links Apoptotic Signaling to Ca2+ Elevation via PDCD6 and FKBP8; Authors - Dennis G Drescher
human	WB	Mol Hum Reprod; Comprehensive analysis of ovarian granulosa cell proteomics and phosphoproteomics in PCOS patients without insulin resistance; Authors - Xiao Yang

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is positive, with a 4-star rating. The reviewer used the antibody for Western Blot on HeLa cells at a 1:1,000 dilution and reported that it worked well. Overall, the feedback is favorable, indicating reliable performance in its tested application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Chun (Verified Customer) (06-19-2022)

This antibody worked well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1,000
• Cell Tissue Type: HeLa cells