FLJ25006 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FLJ25006 Polyclonal antibody, PBS Only (26103-1-PBS)

• 

  WB analysis of mouse liver using 26103-1-AP (same clone as 26103-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26103-1-AP (FLJ25006 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26103-1-PBS in a different storage buffer formulation.

FLJ25006 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26103-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26103-1-PBS targets FLJ25006 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22017

  Product name: Recombinant human FLJ25006 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-171 aa of BC045622

  Sequence: MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQVISMTWASCIEM

• Full Name: uncharacterized serine/threonine-protein kinase SgK494
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC045622
• Gene Symbol: FLJ25006
• Gene ID (NCBI): 124923
• RRID: AB_2880379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.