Filamin A Polyclonal antibody

• 

Filamin A Polyclonal Antibody for ELISA

Cat No. 11140-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ABP 280, ABPX, Actin binding protein 280, Alpha filamin, Filamin 1, Filamin A, FLN, FLN A, FLN1, FLNA, FMD, MNS, NHBP, Non muscle filamin, OPD, OPD1, OPD2

---

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

11140-1-AP targets Filamin A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1581

  Product name: Recombinant human FLNA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2348-2647 aa of BC014654

  Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP

• Full Name: filamin A, alpha (actin binding protein 280)
• Calculated Molecular Weight: 2647 aa, 280 kDa
• GenBank Accession Number: BC014654
• Gene Symbol: FLNA
• Gene ID (NCBI): 2316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21333
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Endocr Connect; FLNA overexpression promotes papillary thyroid cancer aggression via the FAK/AKT signaling pathway; Authors - Weiwei Liang ; KD Validated