Filamin A Monoclonal antibody

Filamin A Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67133-1-Ig
Clone No.1G4H3

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

FLNA, 1G4H3, ABP-280, Actin-binding protein 280, Alpha filamin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, MCF-7 cells, human skeletal muscle tissue, U2OS cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A431 cells
Positive IHC detected inhuman cervical cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67133-1-Ig targets Filamin A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23291

Product name: Recombinant human FLNA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2348-2647 aa of BC014654

Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP

Predict reactive species
Full Name filamin A, alpha (actin binding protein 280)
Calculated Molecular Weight 2647 aa, 280 kDa
Observed Molecular Weight 280 kDa
GenBank Accession NumberBC014654
Gene Symbol FLNA
Gene ID (NCBI) 2316
RRIDAB_2882432
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21333
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLNA encodes a 280 kDa widely expressed actin binding protein called filamin A which can crosslinks actin filaments and links actin filaments to membrane glycoproteins to form a three-dimensional network (PMID:29931263). And filamin A could interact with many other proteins, involved in receptor activation, cell migration and adhesion, cell proliferation, inflammation and tumorigenesis, studies have been reported that FLNA overexpressed in multiple types of tumors, suggesting FLNA may involved in cancer aggressiveness(PMID:29100390). What's more, FLNA is an causative gene of periventricular nodular heterotopia (PNH) (PMID: 29062687)

Protocols

Product Specific Protocols
IF protocol for Filamin A antibody 67133-1-IgDownload protocol
IHC protocol for Filamin A antibody 67133-1-IgDownload protocol
WB protocol for Filamin A antibody 67133-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Front Cell Dev Biol

NudC L279P Mutation Destabilizes Filamin A by Inhibiting the Hsp90 Chaperoning Pathway and Suppresses Cell Migration.

Authors - Min Liu
humanIF

Hum Mol Genet

Expression and subcellular localization of USH1C/harmonin in human retina provides insights into pathomechanisms and therapy

Authors - Kerstin Nagel-Wolfrum
humanIHC

Mol Med Rep

Filamin A regulates EGFR/ERK/Akt signaling and affects colorectal cancer cell growth and migration.

Authors - Kun Wang
humanWB

Cell Death Dis

NudCL2 regulates cell migration by stabilizing both myosin-9 and LIS1 with Hsp90.

Authors - Wenwen Chen
humanIF

J Exp Clin Cancer Res

Focal Adhesion Kinase (FAK)-Hippo/YAP transduction signaling mediates the stimulatory effects exerted by S100A8/A9-RAGE system in triple-negative breast cancer (TNBC).

Authors - Damiano Cosimo Rigiracciolo
humanWB

Cell Death Dis

FRMD3 inhibits the growth and metastasis of breast cancer through the ubiquitination-mediated degradation of vimentin and subsequent impairment of focal adhesion

Authors - Wenjun Shao
Loading...
||
New chat Able
正在加载,请稍候...