Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, MCF-7 cells, human skeletal muscle tissue, U2OS cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A431 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67133-1-Ig targets Filamin A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23291 Product name: Recombinant human FLNA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2348-2647 aa of BC014654 Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP Predict reactive species |
| Full Name | filamin A, alpha (actin binding protein 280) |
| Calculated Molecular Weight | 2647 aa, 280 kDa |
| Observed Molecular Weight | 280 kDa |
| GenBank Accession Number | BC014654 |
| Gene Symbol | FLNA |
| Gene ID (NCBI) | 2316 |
| RRID | AB_2882432 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P21333 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FLNA encodes a 280 kDa widely expressed actin binding protein called filamin A which can crosslinks actin filaments and links actin filaments to membrane glycoproteins to form a three-dimensional network (PMID:29931263). And filamin A could interact with many other proteins, involved in receptor activation, cell migration and adhesion, cell proliferation, inflammation and tumorigenesis, studies have been reported that FLNA overexpressed in multiple types of tumors, suggesting FLNA may involved in cancer aggressiveness(PMID:29100390). What's more, FLNA is an causative gene of periventricular nodular heterotopia (PNH) (PMID: 29062687)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| IHC protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| WB protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Filamin A Monoclonal antibody (Cat# 67133-1-Ig) has 29 citations. These appear in journals including Cancer Research, Theranostics, Journal of Experimental & Clinical Cancer Research, Cell Death & Disease, Cell Death Discovery, Free Radical Biology and Medicine, JCI Insight, Journal of Virology, Human Molecular Genetics, and Science Advances. Research fields span oncology (breast, liver, colorectal, gastric, thyroid, and ovarian cancers), cytoskeletal biology, focal adhesion, cell migration, disulfidptosis, stem cell biology, and viral egress.
| Species | Application | Title |
|---|---|---|
Cancer Res A Noncanonical RNA-Binding Function of NQO1 Drives Angiogenesis in Esophageal Squamous Cell Carcinoma via Extracellular Vesicle-Mediated AGRN Transfer.
| ||
Theranostics The contrasting regulatory effects of valproic acid on ferroptosis and disulfidptosis in hepatocellular carcinoma | ||
J Exp Clin Cancer Res Focal Adhesion Kinase (FAK)-Hippo/YAP transduction signaling mediates the stimulatory effects exerted by S100A8/A9-RAGE system in triple-negative breast cancer (TNBC). | ||
Cell Death Dis FRMD3 inhibits the growth and metastasis of breast cancer through the ubiquitination-mediated degradation of vimentin and subsequent impairment of focal adhesion | ||
Cell Death Dis NudCL2 regulates cell migration by stabilizing both myosin-9 and LIS1 with Hsp90. | ||
Cell Death Discov Thioredoxin system dysregulation and calpain activation drive myocardial disulfidptosis via pathological disulfide bonds remodeling. |
Reviews
What customers say
The single review for this antibody rates it 5 stars. The reviewer used it at a 1:1000 dilution for Western Blot, Immunohistochemistry, and cell culture applications, testing it on SMCs, ECs, HEK293, and fibroblasts. They described it as a "very good antibody working in different cell types," highlighting its versatility across multiple cell lines and assay formats.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gaurav (Verified Customer) (11-14-2025) | Very good antibody working in different cell types
|
