FLYWCH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FLYWCH1 Polyclonal antibody, PBS Only (34047-1-PBS)

• 

  WB analysis using 34047-1-AP (same clone as 34047-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34047-1-AP (FLYWCH1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34047-1-PBS in a different storage buffer formulation.

FLYWCH1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34047-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FLYWCH-type zinc finger-containing protein 1, KIAA1552

---

Product Information

34047-1-PBS targets FLYWCH1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41111

  Product name: Recombinant human FLYWCH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-391 aa of BC018712

  Sequence: MRSHCHQPDLAGLEALRQRERLPTTAQQEDPEKIQVQLCFKTCSPESQQIYGDIKDVRLDGESQ

• Full Name: FLYWCH-type zinc finger 1
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC018712
• Gene Symbol: FLYWCH1
• Gene ID (NCBI): 84256
• RRID: AB_3743143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q4VC44
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.