FMNL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FMNL2 Polyclonal antibody (13038-1-AP)

• 

  WB analysis using 13038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13038-1-AP (FMNL2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13038-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 13038-1-AP (FMNL2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

FMNL2 Polyclonal Antibody for WB, ELISA

Cat No. 13038-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FHOD2, Formin homology 2 domain-containing protein 2, Formin-like protein 2, KIAA1902

---

Tested Applications

• Positive WB detected in: HCT 116 cells, L02 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13038-1-AP targets FMNL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3692

  Product name: Recombinant human FMNL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 880-1057 aa of BC036492

  Sequence: LFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIIT

• Full Name: formin-like 2
• Calculated Molecular Weight: 1092 aa, 124 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC036492
• Gene Symbol: FMNL2
• Gene ID (NCBI): 114793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PY5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FMNL2 (Formin-like 2) is a member of the formin family of actin nucleators that promotes the assembly of unbranched actin filaments. It plays critical roles in cell migration, adhesion, and cytoskeletal remodeling by interacting with Rho GTPases and regulating actin dynamics at the leading edge of migrating cells (PMID: 38891874). Dysregulation of FMNL2 has been implicated in cancer metastasis and inflammatory disorders (PMID: 40212590). This antibody detects a band at 140-150 kDa, which is consistent with the results described in the literature (PMID: 24700756, PMID: 20633255).