FMO1 Recombinant monoclonal antibody

• 

  WB analysis using 83156-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83156-3-RR (FMO1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83156-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83156-3-RR against Human FMO1 were performed. The affinity constant is below 1 pM.

FMO1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83156-3-RR

Clone No.230455B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Trimethylamine monooxygenase, Flavin-containing monooxygenase 1, Fetal hepatic flavin-containing monooxygenase 1, EC:1.14.13.148, Dimethylaniline monooxygenase [N-oxide-forming] 1

---

Tested Applications

• Positive WB detected in: human kidney tissue, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83156-3-RR targets FMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34267

  Product name: Recombinant human FMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-430 aa of NM_001282692

  Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS

• Full Name: flavin containing monooxygenase 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: NM_001282692
• Gene Symbol: FMO1
• Gene ID (NCBI): 2326
• RRID: AB_3670850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q01740
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 and 60 kDa. The observed molecular weight of FMO1 is 53 kDa, which might be the unmodified form of FMO1 (PMID: 9778310).