CoraLite® Plus 750-conjugated FMO1 Recombinant monoclonal antibody

FMO1 Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-83156-3
Clone No.230455B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB

Trimethylamine monooxygenase, Flavin-containing monooxygenase 1, Fetal hepatic flavin-containing monooxygenase 1, EC:1.14.13.148, Dimethylaniline monooxygenase [N-oxide-forming] 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, human liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83156-3 targets FMO1 in WB applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34267

Product name: Recombinant human FMO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 100-430 aa of NM_001282692

Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS

Predict reactive species
Full Name flavin containing monooxygenase 1
Calculated Molecular Weight60 kDa
Observed Molecular Weight53-60 kDa
GenBank Accession NumberNM_001282692
Gene Symbol FMO1
Gene ID (NCBI) 2326
RRIDAB_3673773
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01740
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 and 60 kDa. The observed molecular weight of FMO1 is 53 kDa, which might be the unmodified form of FMO1 (PMID: 9778310).

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 FMO1 antibody CL750-83156-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...