Fibromodulin Polyclonal antibody

Fibromodulin Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 13281-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

FMOD, Collagen-binding 59 kDa protein, FM, Keratan sulfate proteoglycan fibromodulin, KSPG fibromodulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman liver tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

13281-1-AP targets Fibromodulin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4030

Product name: Recombinant human FMOD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-376 aa of BC035281

Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

Predict reactive species
Full Name fibromodulin
Calculated Molecular Weight 376 aa, 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC035281
Gene Symbol Fibromodulin
Gene ID (NCBI) 2331
RRIDAB_2105531
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ06828
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).

Protocols

Product Specific Protocols
IF protocol for Fibromodulin antibody 13281-1-APDownload protocol
WB protocol for Fibromodulin antibody 13281-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

iScience

Fibromodulin overexpression drives oral squamous cell carcinoma via activating downstream EGFR signaling

Authors - Lingyun Xia
mouseWB

J Gerontol A Biol Sci Med Sci

Sex Differences in Response to Diet Enriched with Glutathione Precursors in the Aging Heart

Authors - Aude Angelini
ratWB

FEBS Open Bio

The role of fibromodulin in myocardial fibrosis in a diabetic cardiomyopathy rat model

Authors - Xiyan Dai
Loading...
||
New chat Able
正在加载,请稍候...