Fibromodulin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Fibromodulin Polyclonal antibody (13281-1-AP)

Fibromodulin Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13281-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

FMOD, Collagen-binding 59 kDa protein, FM, Keratan sulfate proteoglycan fibromodulin, KSPG fibromodulin

• 

  WB analysis of human liver using 13281-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13281-1-AP (Fibromodulin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 13281-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Fibromodulin antibody (13281-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Fibromodulin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13281-1-AP targets Fibromodulin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4030

  Product name: Recombinant human FMOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC035281

  Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

• Full Name: fibromodulin
• Calculated Molecular Weight: 376 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC035281
• Gene Symbol: Fibromodulin
• Gene ID (NCBI): 2331
• RRID: AB_2105531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06828
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).

Publications

What published studies show

The Fibromodulin Polyclonal antibody (Cat# 13281-1-AP) has 5 citations published in Biomaterials, Biomaterials Advances, Journal of Gerontology A, iScience, and FEBS Open Bio. Research fields span tendon regenerative repair and extracellular matrix biology, chondrocyte dedifferentiation, aging and cardiac metabolism, oral squamous cell carcinoma with EGFR signaling, and myocardial fibrosis in diabetic cardiomyopathy. Cited applications include Western blotting and immunofluorescence across human, mouse, and rat species.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Biomaterials; Genetically engineered extracellular vesicles-based collagen-targeting bioinspired scaffold for tendon regenerative repair.; Authors - Yan-Jing Zhang ; KD Validated
mouse	IF	Biomater Adv; Time-adaptable alterations of the extracellular matrix during chondrocyte dedifferentiation; Authors - Wenhao Liu
mouse	WB	J Gerontol A Biol Sci Med Sci; Sex Differences in Response to Diet Enriched with Glutathione Precursors in the Aging Heart; Authors - Aude Angelini
human	WB	iScience; Fibromodulin overexpression drives oral squamous cell carcinoma via activating downstream EGFR signaling; Authors - Lingyun Xia
rat	WB	FEBS Open Bio; The role of fibromodulin in myocardial fibrosis in a diabetic cardiomyopathy rat model; Authors - Xiyan Dai