Fibromodulin Polyclonal antibody

• 

  WB analysis of human liver using 13281-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13281-1-AP (Fibromodulin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 13281-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Fibromodulin antibody (13281-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Fibromodulin Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13281-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

FMOD, Collagen-binding 59 kDa protein, FM, Keratan sulfate proteoglycan fibromodulin, KSPG fibromodulin

---

Tested Applications

• Positive WB detected in: human liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

13281-1-AP targets Fibromodulin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4030

  Product name: Recombinant human FMOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC035281

  Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

• Full Name: fibromodulin
• Calculated Molecular Weight: 376 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC035281
• Gene Symbol: Fibromodulin
• Gene ID (NCBI): 2331
• RRID: AB_2105531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06828
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; Fibromodulin overexpression drives oral squamous cell carcinoma via activating downstream EGFR signaling; Authors - Lingyun Xia
mouse	WB	J Gerontol A Biol Sci Med Sci; Sex Differences in Response to Diet Enriched with Glutathione Precursors in the Aging Heart; Authors - Aude Angelini
rat	WB	FEBS Open Bio; The role of fibromodulin in myocardial fibrosis in a diabetic cardiomyopathy rat model; Authors - Xiyan Dai