FNDC3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FNDC3A Polyclonal antibody (25240-1-AP)

FNDC3A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25240-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, RIP, ELISA

Synonyms

Fibronectin type-III domain-containing protein 3A, FNDC3, HUGO

• 

  WB analysis of HEK-293 using 25240-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25240-1-AP (FNDC3A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 25240-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 25240-1-AP (FNDC3A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 25240-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 25240-1-AP (FNDC3A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U-251 using 25240-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using FNDC3A antibody (25240-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FNDC3A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse placenta tissue
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25240-1-AP targets FNDC3A in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18736

  Product name: Recombinant human FNDC3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-250 aa of BC132812

  Sequence: LHRSPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDT

• Full Name: fibronectin type III domain containing 3A
• Calculated Molecular Weight: 1198 aa, 132 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC132812
• Gene Symbol: FNDC3A
• Gene ID (NCBI): 22862
• RRID: AB_2879982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2H6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FNDC3A belongs to the Fibronectin Type III Domain-Containing (FNDC) family and is an evolutionarily conserved, widely expressed protein. FNDC3A is involved in collagen and glycosaminoglycan synthesis, and mediates spermatid-Sertoli adhesion during spermatogenesis.

Publications

What published studies show

The FNDC3A Polyclonal antibody (Cat# 25240-1-AP) has 2 total citations. These appear in Journal of Cellular and Molecular Medicine and Biochimica et Biophysica Acta - Molecular Cell Research. The cited studies focus on gastric cancer progression/metastasis via the miR-206/FNDC3A axis and on FNDC3A's role in epithelial-to-mesenchymal transition, invasion, and stemness in triple-negative breast cancer.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,RIP	J Cell Mol Med; LncRNA SNHG14 Regulated by ZNF460 Promotes Gastric Cancer Progression and Metastasis by Targeting the miR-206/FNDC3A Axis; Authors - Bin Liu
		Biochim Biophys Acta Mol Cell Res; Silencing of fibronectin type III domain-containing protein 3A (FNDC3A) attenuates epithelial-to-mesenchymal transition (EMT), cancer invasion, and stemness in triple-negative breast cancer (TNBC); Authors - Nanaka Wada