FNDC3B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FNDC3B Polyclonal antibody (22605-1-AP)

• Featured Product
• KD/KO Validated

FNDC3B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 22605-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

FAD104, fibronectin type III domain containing 3B, Fibronectin type III domain-containing protein 3B, HCV NS5A-binding protein 37, UNQ2421/PRO4979/PRO34274

• 

  WB analysis of 4T1 using 22605-1-AP

  4T1 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 22605-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 22605-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 22605-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 22605-1-AP

  IP result of anti-FNDC3B (IP:22605-1-AP, 4ug; Detection:22605-1-AP 1:1000) with HepG2 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22605-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22605-1-AP (FNDC3B Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22605-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22605-1-AP (FNDC3B Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FNDC3B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: 4T1 cells, HL-60 cells, HepG2 cells, C6 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22605-1-AP targets FNDC3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18357

  Product name: Recombinant human FNDC3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 3-370 aa of BC039297

  Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV

• Full Name: fibronectin type III domain containing 3B
• Calculated Molecular Weight: 1204 aa, 133 kDa
• Observed Molecular Weight: 150 kDa, 70 kDa
• GenBank Accession Number: BC039297
• Gene Symbol: FNDC3B
• Gene ID (NCBI): 64778
• RRID: AB_2879133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).

Publications

What published studies show

FNDC3B antibody (Cat# 22605-1-AP) has 11 citations across journals including Advanced Science, Cancer Science, PLoS Pathogens, European Journal of Medical Research, Cancers, FASEB Journal, Journal of Cellular Communication and Signaling, Journal of Cellular Physiology, Pediatric Research, American Journal of Translational Research, and NAR Molecular Medicine. Research fields span stroke neuroprotection, multiple cancers (nasopharyngeal, pancreatic, glioma, cervical, gastric, hepatocellular), HIV, Crohn's disease, Hirschsprung's disease, and antisense oligonucleotide safety assessment.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); CircFndc3b Mediates Exercise-Induced Neuroprotection by Mitigating Microglial/Macrophage Pyroptosis via the ENO1/KLF2 Axis in Stroke Mice; Authors - Yun Zhao
human	WB,IHC,IF	Cancer Sci; FNDC3B 3'-UTR shortening escapes from microRNA-mediated gene repression and promotes nasopharyngeal carcinoma progression.; Authors - Ying-Qing Li ; KD Validated
human	WB	PLoS Pathog; The apparent interferon resistance of transmitted HIV-1 is possibly a consequence of enhanced replicative fitness; Authors - Elena Sugrue
human	WB	Cancers (Basel); Integrated Analysis of RNA-Binding Proteins in Glioma.; Authors - Zhixing Wang
human	WB,IHC	Eur J Med Res; Identification of fibronectin type III domain containing 3B as a potential prognostic and therapeutic target for pancreatic cancer: a preliminary analysis; Authors - Yizhi Wang ; KD Validated
human	WB	FASEB J; Circular RNA circFNDC3B Modulates M2 Macrophage Activation and Intestinal Inflammation in Crohn's Disease.; Authors - Juan Yin