FNDC4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FNDC4 Polyclonal antibody (13632-1-AP)

• 

  WB analysis using 13632-1-AP

  Mouse brain lysates treated with or without PNGase F (PNGF) and protease inhibitor were subjected to SDS PAGE followed by western blot with 13632-1-AP (FNDC4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FNDC4 Polyclonal Antibody for WB, ELISA

Cat No. 13632-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1, UNQ6389/PRO21134

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13632-1-AP targets FNDC4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4550

  Product name: Recombinant human FNDC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC032725

  Sequence: MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

• Full Name: fibronectin type III domain containing 4
• Calculated Molecular Weight: 234 aa, 25 kDa
• Observed Molecular Weight: 21 kDa, 36 kDa
• GenBank Accession Number: BC032725
• Gene Symbol: FNDC4
• Gene ID (NCBI): 64838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6D8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FNDC4 is a member of the fibronectin type III domain family of proteins. It is a secreted factor consisting of a C-terminal hydrophobic domain, a type III fibronectin domain, and an N-terminal membrane signaling region. FNDC4 is expressed at the highest levels in the liver and brain, but its expression levels are lower in many other tissues, including the heart, skeletal muscle, and adipose tissue. The N-terminal of FNDC4 can be cleaved, releasing the extracellular portion of the protein. (PMID: 32881638; 27066907)