FNDC4 Polyclonal antibody

FNDC4 Polyclonal Antibody for WB, ELISA
Cat No. 13632-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

UNQ6389/PRO21134, FRCP1, Fibronectin type III repeat-containing protein 1, Fibronectin type III domain-containing protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13632-1-AP targets FNDC4 in WB, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4550

Product name: Recombinant human FNDC4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-234 aa of BC032725

Sequence: MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

Predict reactive species
Full Name fibronectin type III domain containing 4
Calculated Molecular Weight 234 aa, 25 kDa
Observed Molecular Weight25-30 kDa
GenBank Accession NumberBC032725
Gene Symbol FNDC4
Gene ID (NCBI) 64838
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6D8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FNDC4 is a member of the fibronectin type III domain family of proteins. It is a secreted factor consisting of a C-terminal hydrophobic domain, a type III fibronectin domain, and an N-terminal membrane signaling region.

Protocols

Product Specific Protocols
WB protocol for FNDC4 antibody 13632-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...