FNDC4 Polyclonal antibody

• 

  WB analysis using 13632-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 13632-1-AP (FNDC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

FNDC4 Polyclonal Antibody for WB, ELISA

Cat No. 13632-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

UNQ6389/PRO21134, FRCP1, Fibronectin type III repeat-containing protein 1, Fibronectin type III domain-containing protein 4

---

Tested Applications

• Positive WB detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13632-1-AP targets FNDC4 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4550

  Product name: Recombinant human FNDC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC032725

  Sequence: MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

• Full Name: fibronectin type III domain containing 4
• Calculated Molecular Weight: 234 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC032725
• Gene Symbol: FNDC4
• Gene ID (NCBI): 64838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6D8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FNDC4 is a member of the fibronectin type III domain family of proteins. It is a secreted factor consisting of a C-terminal hydrophobic domain, a type III fibronectin domain, and an N-terminal membrane signaling region.