FNIP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FNIP2 Polyclonal antibody, PBS Only (31283-1-PBS)

• 

  IP experiment of HEK-293 using 31283-1-AP (same clone as 31283-1-PBS)

  IP result of anti-FNIP2 (IP:31283-1-AP, 4ug; Detection:31283-1-AP 1:500) with HEK-293 cells lysate 1470 ug. This data was developed using the same antibody clone with 31283-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 31283-1-AP (same clone as 31283-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31283-1-AP (FNIP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31283-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 31283-1-AP (same clone as 31283-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31283-1-AP (FNIP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31283-1-PBS in a different storage buffer formulation.

FNIP2 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 31283-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, Indirect ELISA

Synonyms

---

Product Information

31283-1-PBS targets FNIP2 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35014

  Product name: Recombinant human FNIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 740-885 aa of BC166693

  Sequence: ERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEG

• Full Name: folliculin interacting protein 2
• Observed Molecular Weight: 125 kDa
• GenBank Accession Number: BC166693
• Gene Symbol: FNIP2
• Gene ID (NCBI): 57600
• RRID: AB_3669929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P278
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Folliculin (FLCN)-interacting proteins 1 and 2 (FNIP1, FNIP2) are homologous binding partners of FLCN, a tumor suppressor for kidney cancer. FNIP2 was found to bind to the C terminus of FLCN and to AMPK, like FNIP1. FNIP2 competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PMID: 18403135).