FOLR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FOLR2 Polyclonal antibody (34328-1-AP)

• 

  WB analysis using 34328-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34328-1-AP (FOLR2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

FOLR2 Polyclonal Antibody for WB, ELISA

Cat No. 34328-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Fbp2, Folate receptor 2, Folate receptor beta, Folate-binding protein 2, Folbp2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34328-1-AP targets FOLR2 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg7561

  Product name: Recombinant mouse FOLR2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-227 aa of NM_008035.2

  Sequence: RDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCSVNTSQELHKADSRLYFNWDHCGKMEPACKSHFIQDSCLYECSPNLGPWIQQVDQSWRKERFLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASLCEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDVVKFYASFMTS

• Full Name: folate receptor 2 (fetal)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_008035.2
• Gene Symbol: Folr2
• Gene ID (NCBI): 14276
• RRID: AB_3743191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q05685
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Folate receptor beta (FOLR2, also known as FR-β) is a glycosylphosphatidylinositol (GPI)-anchored cell surface folate-binding protein that mediates high-affinity uptake of reduced folates and folate conjugates. In mice, Folr2 is predominantly expressed in subsets of tissue-resident macrophages and monocyte/macrophage-lineage cells, rather than in most epithelial compartments. It is particularly enriched in alternatively activated (M2-like) macrophages, tumor-associated macrophages (TAMs), and macrophage populations associated with tissue remodeling, immune regulation, and chronic inflammation. Through facilitating folate internalization and reflecting a specialized macrophage activation state, FOLR2 is widely used as a marker for immunoregulatory macrophages in contexts such as tumor microenvironment, fibrosis, wound healing, and inflammatory disease.