FOSL2 Polyclonal antibody

• 

  WB analysis using 15832-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15832-1-AP (FOSL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

FOSL2 Polyclonal Antibody for WB, ELISA

Cat No. 15832-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, ELISA

Synonyms

Fos L2, FosL 2, Fos-related antigen 2, FRA 2, FRA2

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 2 publications below

Product Information

15832-1-AP targets FOSL2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8397

  Product name: Recombinant human FOSL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC008899

  Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC

• Full Name: FOS-like antigen 2
• Calculated Molecular Weight: 326 aa, 35 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC008899
• Gene Symbol: FOSL2
• Gene ID (NCBI): 2355
• RRID: AB_2878188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5M2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; LncRNA GUARDIN suppresses cellular senescence through a LRP130-PGC1α-FOXO4-p21-dependent signaling axis.; Authors - Xuedan Sun
pig	WB	Front Immunol; Foot-and-Mouth Disease Virus Counteracts on Internal Ribosome Entry Site Suppression by G3BP1 and Inhibits G3BP1-Mediated Stress Granule Assembly via Post-Translational Mechanisms.; Authors - Xu Ye
human	WB	J Exp Clin Cancer Res; Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway.; Authors - Yu Lian ; KD Validated
human	WB	Biomed Pharmacother; MiR-133a acts as an anti-oncogene in Hepatocellular carcinoma by inhibiting FOSL2 through TGF-β/Smad3 signaling pathway.; Authors - Lu Sun ; KD Validated
human	WB	Ophthalmol Ther; Effect of Ritanserin and Duloxetine on the Gene Expression of Primary Aniridia and Healthy Human Limbal Stromal Cells, In Vitro; Authors - Zhen Li
rat	WB,IHC	Mol Med Rep; MicroRNA‑21 serves an important role during PAOO‑facilitated orthodontic tooth movement.; Authors - Yuanyuan Zhang