FOSL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FOSL2 Polyclonal antibody (15832-1-AP)

• Featured Product
• KD/KO Validated

FOSL2 Polyclonal Antibody for WB, ELISA

Cat No. 15832-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

Synonyms

Fos L2, FosL 2, Fos-related antigen 2, FRA 2, FRA2

• 

  WB analysis using 15832-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15832-1-AP (FOSL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15832-1-AP targets FOSL2 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8397

  Product name: Recombinant human FOSL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC008899

  Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC

• Full Name: FOS-like antigen 2
• Calculated Molecular Weight: 326 aa, 35 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC008899
• Gene Symbol: FOSL2
• Gene ID (NCBI): 2355
• RRID: AB_2878188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5M2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF	J Cereb Blood Flow Metab; EXPRESS: SPI1 promotes endothelial cell ferroptosis and intracranial aneurysm progression via EP300-mediated FOSL2 acetylation.; Authors - Lingfeng Lai
mouse	WB	Life Sci; FOSL2(+) macrophages drive pro-inflammatory phenotype via miR-92a-3p/FOSL2/NF-κB axis to mediate endothelial cell injury in aortic dissection.; Authors - Zhenpeng Yuan ; KD Validated
human,mouse,rat	WB	Stem Cell Res Ther; Mesenchymal stem cells inhibit mitochondrial fission by upregulating armadillo repeat containing 1, ameliorating oxidative stress in renal fibrosis.; Authors - Tao Li
human	WB	PLoS One; Fatty acid-binding protein 5 (FABP5) modulates limbal epithelial cell homeostasis by regulating the expression of key genes under both normal and inflammatory conditions, in vitro.; Authors - Maryam Amini